SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8AEU6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8AEU6
Domain Number 1 Region: 152-207,395-443
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000183
Family Pseudo ankyrin repeat 0.041
Further Details:      
 
Domain Number 2 Region: 307-447
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000796
Family Ankyrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2J8AEU6
Sequence length 579
Comment (tr|A0A2J8AEU6|A0A2J8AEU6_9CHLO) Uncharacterized protein {ECO:0000313|EMBL:PNH11026.1} OX=47790 OS=Tetrabaena socialis. GN=TSOC_002188 OC=Chlamydomonadales; Tetrabaenaceae; Tetrabaena.
Sequence
MAPVRSDQAGGGHPSVQCSMELQRAHKRQQRFQSPASPPQQQHSDPSRIWLPDIVQRVAV
SLTPNEVAGTLRLVNKATAAQLSTPQHTTVWLSQPVPHHAFVGRWAGPDSMRTLEWKQRH
ELTRLTACSGSIANLEVLLARDDMPAMLKHDVFVAAAAAGQLGVCIWLRERGCCRNDRLV
LRAAARTGQQAVCEWLLANGCPEADTYGNAAAKAAEGGHVSLMDWLLLHAGSAHVESVLA
GAAVGCDLHDTYVDTLPGGQPEQYSPFLLSAAAGSPTADWQAKVEWLEARGYPTSCACWA
AAARPHMFPRLQWLRQRGYPLDEFMAGCAAGAGNVEALQYVLDEGVRGGHVAVLEMLDAR
GAHRSGQTVRTAAAAAHLPAVAWLVEKLGAAAALTARVFEAAARAGSMELLRWLRARGCP
WDATVFAAAAEGGSEEQLEWLVEQGCPMGVGAGGDSDRSSAAAADPSTQQQVPPPSVVLE
PVIVAAPARVLVASNGEAAPPAIRQSARLRLLRGRPPEAEGDYLTLSAYASKFEAELSPP
KPAPAPAPMAAPELVEAPAAEAAAEAPAAELTEAEVAAE
Download sequence
Identical sequences A0A2J8AEU6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]