SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8CH76 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8CH76
Domain Number 1 Region: 28-95
Classification Level Classification E-value
Superfamily Hydrophobin II, HfbII 2.62e-22
Family Hydrophobin II, HfbII 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2J8CH76
Sequence length 95
Comment (tr|A0A2J8CH76|A0A2J8CH76_VERDA) Uncharacterized protein {ECO:0000313|EMBL:PNH36370.1} OX=27337 OS=Verticillium dahliae (Verticillium wilt). GN=BJF96_g188 OC=Plectosphaerellaceae; Verticillium.
Sequence
MQFTIVAALFASVAMAAPATLHARATVCPTGLLYGVAQCCATSVLGVADLDCSVPSSTPS
DGADLKRICAESGAAAMCCSIPLAGQGVLCTPVIG
Download sequence
Identical sequences A0A2J8CH76 G2XFX7
XP_009655054.1.79873 VDAG_08956T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]