SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8E4I5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8E4I5
Domain Number 1 Region: 76-180
Classification Level Classification E-value
Superfamily FAD-dependent thiol oxidase 9.94e-39
Family FAD-dependent thiol oxidase 0.0000117
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2J8E4I5
Sequence length 200
Comment (tr|A0A2J8E4I5|A0A2J8E4I5_VERDA) Uncharacterized protein {ECO:0000313|EMBL:PNH56432.1} OX=27337 OS=Verticillium dahliae (Verticillium wilt). GN=BJF96_g6429 OC=Plectosphaerellaceae; Verticillium.
Sequence
MTRRQHLSAIVVLAIVAFFSVSYLFSSGIRDGTSSHSAPAPLVKDSTPAAAFDIGTIDSN
ILVGGSIAPKLENATAKAELGRASWKFLHTMMGRFPDKPSPEESLTLKTFITLFSRLYPC
GDCASHFQKLIAKYPPQVSSRTAAAGWLCFVHNEVNTRLEKDLFDCANIGDFYDCGCGDE
DKKKKEAGEGVELRGDDSKA
Download sequence
Identical sequences A0A2J8E4I5 G2WXE4
XP_009651871.1.79873 VDAG_02923T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]