SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8FHU7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2J8FHU7
Domain Number - Region: 6-58
Classification Level Classification E-value
Superfamily FAD-dependent thiol oxidase 0.00549
Family FAD-dependent thiol oxidase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2J8FHU7
Sequence length 110
Comment (tr|A0A2J8FHU7|A0A2J8FHU7_VERDA) Uncharacterized protein {ECO:0000313|EMBL:PNH73342.1} OX=27337 OS=Verticillium dahliae (Verticillium wilt). GN=BJF96_g1062 OC=Plectosphaerellaceae; Verticillium.
Sequence
MGLAYNTYLNSSKIYGCKTCKAHLANHEDIISRNFRGQHGKAYLFNNVVNIDMGEPSERN
MTTGRHIVRDITCRQCKETVGWKYDKAYETTEKYKEGKFILEAELLCNVT
Download sequence
Identical sequences A0A0G4LM03 A0A2J8FHU7 C9SR57 G2X8Y3
XP_003002398.1.67963 XP_009657614.1.79873 VDBG_06969T0 VDAG_06615T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]