SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8FMH1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8FMH1
Domain Number 1 Region: 27-220
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 2.22e-27
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.0003
Further Details:      
 
Domain Number 2 Region: 419-529
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000719
Family Pseudo ankyrin repeat 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2J8FMH1
Sequence length 621
Comment (tr|A0A2J8FMH1|A0A2J8FMH1_VERDA) Uncharacterized protein {ECO:0000313|EMBL:PNH74959.1} OX=27337 OS=Verticillium dahliae (Verticillium wilt). GN=VD0001_g2567 OC=Plectosphaerellaceae; Verticillium.
Sequence
MDPSDNMLLHLRRSNSSSSSLHFKPRDRKLRLLVAATGPRDISWASALVVRLSKNPGIEM
RAIVDDVIPRLSQTIIVMHNRPMVAPLVNAAAGTGTGTGTGTDAESKSERDDIEFYRQQA
FGLVEWADLMVLVPIDADNLAKMMAGIADTLLLEVLRGWDSAKKILLVPGMSTHMWENPV
TKRQMSKIHRKWHWLRPMPPILWHYDDNPKTPKRIVNWSAFNDILSIIKNQADLMGLGRD
VDVVSHLSGNLTASPNRPIHSKLPPEIWTIILDFTQDWELAQALGVYTNAVMPHPWTLTP
KDPRDPIQVYAHELEWLVLTCNSPAICKKLLQSPPALHDLPALVIKLIIRFSLIDVLAWM
EANRPDLFKAFDGKVLPTKASAYYGRPDVLDYWKQSRFFHHGAARAPRTDASDLYDASAL
DGASKNGFVRVLDWWWRRSGLPLVFTEAALEQASGKGHLLVLEWWRDAAAQDDRIVLRPG
KSLLWAAQHGQAAVLRWWVASGIPVAHGDSVAKMASRWGQVDVLELWRQLKGDDKLVFDA
EVLVQPTIHQHVDVLEWWRRFAHGELDAMDGRRHRVEYRTCDIEEALEDSIGDQEKVRRW
WARVGLNLGLRNIEWMRTKCL
Download sequence
Identical sequences A0A2J8FMH1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]