SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8IL57 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2J8IL57
Domain Number - Region: 44-75
Classification Level Classification E-value
Superfamily Defensin-like 0.0113
Family Defensin 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2J8IL57
Sequence length 78
Comment (tr|A0A2J8IL57|A0A2J8IL57_PANTR) DEFB105A isoform 1 {ECO:0000313|EMBL:PNI11251.1} OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0055740 OC=Catarrhini; Hominidae; Pan.
Sequence
MALIKKTFFFLFAMFFILVQLSSGCQAGLDFSQPFPSGEFAVCESCKLGRGKCRKECLEN
EKPDGNCRLNFLCCRQRI
Download sequence
Identical sequences A0A2J8IL57 Q5IAB6
ENSPTRP00000034193 ENSPTRP00000034193 9598.ENSPTRP00000034193 NP_001123225.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]