SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8K514 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2J8K514
Domain Number - Region: 37-105
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.00209
Family Transglutaminase, two C-terminal domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2J8K514
Sequence length 183
Comment (tr|A0A2J8K514|A0A2J8K514_PANTR) SSR2 isoform 10 {ECO:0000313|EMBL:PNI30120.1} OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0041289 OC=Catarrhini; Hominidae; Pan.
Sequence
MRLLSFVVLALFAVTQAEEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGSSAALDVELS
DDSFPPEDFGIVSGMLNVKWDRIAPASNVSHTVVLRPLKAGYFNFTSATITYLAQEDGPV
VIGSTSAPGQGGILAQREFDRRFSPHFLDWAAFGVMTLPSIGIPLLLWYSSKRKYDTPKT
KKN
Download sequence
Identical sequences A0A2I3HPW5 A0A2J8K514 A0A2J8VGN8 P43308
gi|4507239|ref|NP_003136.1| ENSNLEP00000014951 HR181 ENSP00000295702 9606.ENSP00000295702 ENSP00000295702 ENSP00000434306 ENSPTRP00000002439 ENSP00000295702 ENSP00000434306 NP_003136.1.87134 NP_003136.1.92137 XP_004089904.1.23891 XP_004089905.1.23891 ENSNLEP00000014951 ENSPTRP00000002439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]