SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8KKN7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8KKN7
Domain Number 1 Region: 14-62
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 2.88e-19
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000775
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2J8KKN7
Sequence length 131
Comment (tr|A0A2J8KKN7|A0A2J8KKN7_PANTR) PRKAR1A isoform 6 {ECO:0000313|EMBL:PNI35582.1} OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0038049 OC=Catarrhini; Hominidae; Pan.
Sequence
MESGSTAASEEARSLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFERLEKE
EAKQIQNLQKAGTRTDSREDEISPPPPNPVVKGRRRRGAISAEVYTEEDAASYVRKFFSR
LYQKITRQWPL
Download sequence
Identical sequences A0A2J8KKN7 K7EMZ6
ENSP00000466722 ENSP00000466722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]