SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8M8I9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8M8I9
Domain Number 1 Region: 1216-1448
Classification Level Classification E-value
Superfamily Nudix 3.31e-28
Family MutT-like 0.0000957
Further Details:      
 
Weak hits

Sequence:  A0A2J8M8I9
Domain Number - Region: 194-253,302-365
Classification Level Classification E-value
Superfamily MCP/YpsA-like 0.00137
Family MoCo carrier protein-like 0.01
Further Details:      
 
Domain Number - Region: 455-516
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0654
Family Pseudo ankyrin repeat 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2J8M8I9
Sequence length 1448
Comment (tr|A0A2J8M8I9|A0A2J8M8I9_PANTR) TRPM2 isoform 5 {ECO:0000313|EMBL:PNI55839.1} OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0022950 OC=Catarrhini; Hominidae; Pan.
Sequence
MEPSALRKAGSEQEGFEGLPRRVTDLGMVSNLRRSNSSLFKSWRLQCPFGNNDKQESLSS
WIPENIKKKECVYFVESSKLSDAGKVVCQCGYTHEQHLEEATKPHTFQGTQWDPKKHVQE
MPTDAFGDIVFTGLSQKVKKYVRVSQDTPSSVIYHLMTQHWGLEVPNLLISVTGGAKNFN
MKPRLKSIFRRGLVKVAQTTGAWIITGGSHAGVMKQVGEAVRDFSLSSSYKEGELITIGV
ATWGTVHRREGLIHPTGSFPAEYILDEDGQGNLTCLDSNHSHFILVDDGTHGQYGVEIPL
RTRLEKFISEQTKERGGVAIKIPIVCVVLEGGPGTLHTIYNATTNGTPCVVVEGSGRVAD
VIAQVANLPVSDITISLIQQKLSVFFQEMFETFTESRIVEWTKKIQDIVRRRQLLTVFRE
GKDGQQDVDVAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFTDEWQWKP
SDLHPTMTAALISNKPEFVKLFLENGVQLKEFVTWDTLLYLYENLDPSCLFHSKLQMHHV
AQVLRELLGDFTQPLYPRPPHNGRPRLLLPVPHVKLNVQGVSLWSLYKRSSGHVTFTMDP
IRDLLIWAIVQNRRELAGIIWAQSQDCIAAALACSKILKELSKEEEDTDSSEEMLALAEE
YEHRAIGVFTECYRKDEERAQKLLTRVSEAWGKTTCLQLALEAKDMKFVSHGGIQAFLTK
VWWGQLSVDNGLWRVTLCMLAFPLLLTGLISFREKRLQEVGTPAARARAFFTAPVVVFHL
NILSYFAFLCLFAYVLMVDFQPVPSWCECAIYLWLFSLVCEEMRQLFYDPDECGLMKKAA
LYFSDFWNKLDVGAILLFVAGLTCRLIPVTLYPGRVILSLDFILFCLRLMHIFTISKTLG
PKIIIVKRMMKDVFFFLFLLAVWVVSFGVAKQAILIHNERRVDWLFRGAVYHSYLTIFGQ
IPGYIDGVNFNPEHCSPNGTDPYKPKCPESDATQQRPAFPEWLTVLLLCLYLLFTNILLL
NLLIAMFNYTFQQVQEHTDQIWKFQRHDLIEEYHGRPAAPPPFILLSHLQLFIKRVVLKT
PAKRHKQLKNKLEKNEEAALLSWEIYLKENYLQNRQFQQKQRPEQKIEDISNKVDAMVDL
LDLDPLKRMGSMEQRLASLEEQVAQTARALHWIVRTLRASGFSSEADVPTLASQKAVEEP
DAEPGGRKKTEEPGDSYHVNARHLLYPNCPVTRFPVPNEKVPWETEFLIYDPPFYTAERK
DAAAMDPVGENPMGRTGLRGRGSLSCFGPNHTLYPMVTRWRRNEDGAICRKSIKKMLEVL
VVKLPLSEHWALPGGSREPGETLPRKLKRILRQEHWPSFENLLKCGMEVYKGYMDDPRNT
DNAWIETVAVSVHFQDQNDVELNRLNSNLHACDSGASIRWQVVDRRIPLHANHKTLLQKA
AAEFGAHY
Download sequence
Identical sequences A0A2J8M8I9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]