SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8NFH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8NFH2
Domain Number 1 Region: 26-94
Classification Level Classification E-value
Superfamily Interleukin 8-like chemokines 2.49e-23
Family Interleukin 8-like chemokines 0.0000284
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2J8NFH2
Sequence length 95
Comment (tr|A0A2J8NFH2|A0A2J8NFH2_PANTR) CCL20 isoform 1 {ECO:0000313|EMBL:PNI70503.1} OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0010930 OC=Catarrhini; Hominidae; Pan.
Sequence
MCCTKSLLLAALMSVLLLHLCSESEASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDIN
AIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM
Download sequence
Identical sequences A0A2J8NFH2
XP_008973555.1.60992 XP_009442757.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]