SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8QXD8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8QXD8
Domain Number 1 Region: 53-234
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.06e-44
Family Ankyrin repeat 0.00029
Further Details:      
 
Domain Number 2 Region: 275-338
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000143
Family SAM (sterile alpha motif) domain 0.023
Further Details:      
 
Domain Number 3 Region: 245-300,385-421
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000196
Family Pseudo ankyrin repeat 0.033
Further Details:      
 
Weak hits

Sequence:  A0A2J8QXD8
Domain Number - Region: 354-458
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0115
Family HBL-like 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2J8QXD8
Sequence length 475
Comment (tr|A0A2J8QXD8|A0A2J8QXD8_PANTR) ASZ1 isoform 2 {ECO:0000313|EMBL:PNJ00930.1} OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0011795 OC=Catarrhini; Hominidae; Pan.
Sequence
MAASALRGLPVAGGGESSESEDDGWEIGYLDRTSQKLKGLLPIEEKKEKFKKAMTIGDVS
LVQELLDSGISVDSTFQYGWTPLMYAASVANAELVRVLLDRGANASFEKDKQSILITACS
AHGSEEQILKCVELLLSRNADPNVACRRLMTPIMYAARDGHTQVVALLVAHGAEVNTQDE
NGYTALTWAARQGHKNIVLKLLELGANKMLQTKDGKMPSEIAKRNKHHEIFNLLSFTLNP
LEGKLQQLTKEDTICKILTTDSDREKDHIFSSYTAFGDLEVFLHGLGLEHMTDILKERDI
TLRHLLTMREDEFTKNGITSKDQQKILAALKELQVEEIQFGELSEETKLEISGDEFLNFL
LKLNKQCGHLITAVQNVITELPVNSQKITLEWASPQNFTSVCEELVNNVEDLSEKVCKLK
DLIQKLQNERESDPTHIQLREEVSTWNSRILKRTAITICGFGFLLFICKLTFQRK
Download sequence
Identical sequences A0A2J8QXD8 Q8WMX6
9598.ENSPTRP00000033595 ENSPTRP00000033595 NP_001009035.1.37143 XP_003808696.1.60992 ENSPTRP00000033595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]