SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8SE27 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8SE27
Domain Number 1 Region: 253-302
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.000000000000497
Family TB module/8-cys domain 0.0023
Further Details:      
 
Domain Number 2 Region: 2-95
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000204
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 3 Region: 196-246
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000326
Family EGF-type module 0.011
Further Details:      
 
Domain Number 4 Region: 162-207
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000518
Family EGF-type module 0.0077
Further Details:      
 
Domain Number 5 Region: 108-143
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000753
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2J8SE27
Sequence length 303
Comment (tr|A0A2J8SE27|A0A2J8SE27_PONAB) LTBP4 isoform 20 {ECO:0000313|EMBL:PNJ19036.1} OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0044001 OC=Catarrhini; Hominidae; Pongo.
Sequence
ECLNTDGSFACTCAPGYRPGPRGASCLDVDECSEEDLCQSGICTNTDGSFECVCPPGHRA
GPDLASCLDVDECRERGPALCGSQRCENSPGSYRCVRDCDPGYHAGPEGTCDDVNECETL
QGVCGAALCENVEGSFLCVCPNSPEEFDPMTGRCVPPRTSADVDECQLFRDQVCKNGVCV
NTAPGYSCYCSNGYYYHTQRLECIDNDECADEEPACEGGRCVNTVGSYHCTCEPPLVLDG
SQRRCVSNESQSLDDNMGVCWQEVGADLVCSHPRLDRQATYTECCCLYGEAWGMDCALCP
AQD
Download sequence
Identical sequences A0A2J8SE27

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]