SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8TNR9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8TNR9
Domain Number 1 Region: 235-498
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.21e-86
Family Eukaryotic proteases 0.000000000504
Further Details:      
 
Domain Number 2 Region: 150-238
Classification Level Classification E-value
Superfamily Kringle-like 7.49e-32
Family Kringle modules 0.00000743
Further Details:      
 
Domain Number 3 Region: 36-85
Classification Level Classification E-value
Superfamily FnI-like domain 2.2e-20
Family Fibronectin type I module 0.0000857
Further Details:      
 
Domain Number 4 Region: 83-128
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000251
Family EGF-type module 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2J8TNR9
Sequence length 499
Comment (tr|A0A2J8TNR9|A0A2J8TNR9_PONAB) PLAT isoform 8 {ECO:0000313|EMBL:PNJ34675.1} OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0033297 OC=Catarrhini; Hominidae; Pongo.
Sequence
MNAMKRGLCCVLLLCGAVFALPSQEIHARVRRGARSYQVICRDEKTQMIYQQHQSWLRPV
LRSNRVEYCWCNSGRAQCHSVPVRSCSEPRCFNGGTCQQALYFSDFVCQCPEGFAGKCCE
IDSKPWCYVFKAGKYSSEFCSTPACSEGNSDCYFGNGLAYRGTHSLTESGASCLLWNSMI
LIGKVYTAQNPNAQALGLGKHNYCRNPDGDAKPWCHVLKNRRLTWEYCDVPSCSTCGLRQ
YSQPQFRIKGGLFADIASHPWQAAIFAKHRRSPGERFLCGGILISSCWILSAAHCFQERF
PPHHLTVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSRCAQES
SVVRTVCLPPADLQLPDWTECELSGYGKHEALSPFYSERLKEAHVRLYPSSRCTSQHLLN
RTVTDNMLCAGDTRSGGPQANLHDACQGDSGGPLVCLNDGRMTLVGIISWGLGCGEKDVP
GVYTKVTNYLDWIHDNMRP
Download sequence
Identical sequences A0A2J8TNR9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]