SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8TV06 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8TV06
Domain Number 1 Region: 6-46
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000000000575
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2J8TV06
Sequence length 212
Comment (tr|A0A2J8TV06|A0A2J8TV06_PONAB) ROPN1B isoform 2 {ECO:0000313|EMBL:PNJ36862.1} OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0032024 OC=Catarrhini; Hominidae; Pongo.
Sequence
MAQTDKPTCVPPELPKMLKEFAKAAIRAQPQDLIQWGADYFEALSRGEMPPVREQSERVP
LCNWAELTPELLKILHSQVAGRLIIHAEELAQMWKVVNLPTDLFNSVMNVGRFTEEIEWL
KFLALACSALGVTITKTLKIVCEVLSCDHNGGLPRIPFSTFQFLYTYIAEVDGEICASHV
SRMLNYIEQEVIGPDGLITVNDFTQNPMVWLE
Download sequence
Identical sequences A0A2J8TV06

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]