SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J8XSX4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J8XSX4
Domain Number 1 Region: 5-190
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.12e-53
Family D-ribulose-5-phosphate 3-epimerase 0.0000055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2J8XSX4
Sequence length 199
Comment (tr|A0A2J8XSX4|A0A2J8XSX4_PONAB) RPE isoform 1 {ECO:0000313|EMBL:PNJ85136.1} OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0047652 OC=Catarrhini; Hominidae; Pongo.
Sequence
MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQ
LGQDPFFDMHMMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIK
PGTSVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKAGANMIVSGSAIMRSEDPRSV
INLLRNVCSEAAQKRSLDR
Download sequence
Identical sequences A0A1D5RFF3 A0A2I3HSC9 A0A2I3LGA5 A0A2I3TT16 A0A2J8XSX4 A0A2K5IG37 A0A2K5NYN2 A0A2K5TU95 A0A2K5YQM9 A0A2K6DFX4 A0A2K6JPU7 A0A2K6PD08
ENSP00000346501 ENSP00000439206 NP_001265214.1.87134 NP_001265214.1.92137 XP_003254068.1.23891 XP_011787723.1.43180 XP_011821924.1.47321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]