SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J9AB22 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2J9AB22
Domain Number - Region: 173-209
Classification Level Classification E-value
Superfamily Nuclear receptor coactivator interlocking domain 0.00942
Family Nuclear receptor coactivator interlocking domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2J9AB22
Sequence length 271
Comment (tr|A0A2J9AB22|A0A2J9AB22_9CYAN) Uncharacterized protein {ECO:0000313|EMBL:PNK15980.1} OX=2014880 OS=Cylindrospermopsis raciborskii S06. GN=CEP09_08000 OC=Cylindrospermopsis.
Sequence
MVNRPTNSNTSLTLKVVGIVCILSFFIDFLILMLGFNFTDKQAQVGLTTALVDRGVVPMV
GLAMILIAHWLDTNDQGKNPGMDFKFPSLILSSIFGLMFLLIFPLHLTNVDQVSKEKVNQ
IAQDAQQAESQLNTQLAQFQGQLNNDQGRAQLQQAQLQAKAQITELLKDPQKYKQALENP
QLPPEQKELLKKLQANPQDIDKFIAQQTDPNEIAKQKIEQIRQRQREAEKQAKENAWKSG
LRIGIGSLLLSIGYIIIGWTGLKTTSGTRRV
Download sequence
Identical sequences A0A2J8YFF7 A0A2J8YQJ0 A0A2J8YWE9 A0A2J8ZKF5 A0A2J8ZL37 A0A2J8ZR27 A0A2J9A468 A0A2J9AB22 A0A2J9AHR3 D4TEL8
WP_006276375.1.50351 WP_006276375.1.5838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]