SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J9PBJ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2J9PBJ2
Domain Number - Region: 17-143
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00732
Family Pseudo ankyrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2J9PBJ2
Sequence length 171
Comment (tr|A0A2J9PBJ2|A0A2J9PBJ2_BORBG) Uncharacterized protein {ECO:0000313|EMBL:PNL87607.1} OX=139 OS=burgdorferi). GN=A6J35_001690 OC=Bacteria; Spirochaetes; Spirochaetales; Borreliaceae; Borreliella.
Sequence
MKIQIIIMLLALLDFPLNARLLDISIEKRADEEIKKYSSYNLILEKEYYTNFPTSEIEKN
IYKLTEHFVKSIMLNKTNYSLLNSNYKEANKYLIQSELIDKKFLKYKIFKIKNINGIFKS
HSLIYTKKGFYKLELYIENNAEPLKIFNLNITYFLKNLDKISNEMIFFPRE
Download sequence
Identical sequences A0A0H3C226 A0A2J9PBJ2 O51616
gi|218249316|ref|YP_002375173.1| NP_212807.1.46978 WP_002657403.1.100172 WP_002657403.1.1709 WP_002657403.1.18535 WP_002657403.1.23946 WP_002657403.1.30682 WP_002657403.1.38241 WP_002657403.1.41722 WP_002657403.1.44797 WP_002657403.1.58911 WP_002657403.1.72823 WP_002657403.1.75039 WP_002657403.1.96757 224326.BB0673 445985.BbuZS7_0693 gi|15595018|ref|NP_212807.1| gi|530321571|ref|YP_008407837.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]