SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J9PGU7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2J9PGU7
Domain Number - Region: 188-289
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0353
Family Pseudo ankyrin repeat 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2J9PGU7
Sequence length 377
Comment (tr|A0A2J9PGU7|A0A2J9PGU7_STRPY) ISAs1-like element IS1548 family transposase {ECO:0000313|EMBL:PNL89220.1} OX=1314 OS=Streptococcus pyogenes. GN=A6J29_000815 OC=Streptococcus.
Sequence
MIDFIISIDDCAVELDSRQSWKIGYPLSTILFLVFVCQLAGIETWKEMEDFIEMNEPLFA
TYVDLSEGCPSHDTLERVISLVNSDRLKELKVQFEQSLTSLDAVHQLISVDGKTIRGNRG
KNQKPVHIVTAYDGGHHLSLGQVAVEEKSNEIVAIPQLLRTIDIRKSIVTIDAMGTQTAI
VDTIIKGKADYCLAVKGNQETLYDDIALYFSDVNLLEELQENAQYYQTVEKSRGQIEVRE
YWVSSDIKWLCQNHPKWHKLRGIGMTRNTIDKDGQLSQENRYFIFSFKPDVLTFANCVRG
HWQIESMHWLLDVVYHEDHHQTLDKRAAFNLNLIRKMCLYFLKVMVFPKKDLSYRRKQRY
ISVHLEDYLVQLFGERG
Download sequence
Identical sequences A0A2J9PGU7
gi|383479739|ref|YP_005388633.1| gi|383480671|ref|YP_005389565.1| WP_014407456.1.20146 WP_014407456.1.2016 WP_014407456.1.24256 WP_014407456.1.24771 WP_014407456.1.35339 WP_014407456.1.3764 WP_014407456.1.38004 WP_014407456.1.41398 WP_014407456.1.49019 WP_014407456.1.52414 WP_014407456.1.57973 WP_014407456.1.6624 WP_014407456.1.68539 WP_014407456.1.87861 WP_014407456.1.8796 WP_014407456.1.88361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]