SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2J9VC67 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2J9VC67
Domain Number 1 Region: 3-143
Classification Level Classification E-value
Superfamily Phage tail protein-like 1.07e-18
Family Lambda phage gpU-like 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2J9VC67
Sequence length 147
Comment (tr|A0A2J9VC67|A0A2J9VC67_VIBVL) Phage tail protein {ECO:0000313|EMBL:PNM61387.1} OX=672 OS=Vibrio vulnificus. GN=AL546_009925 OC=Vibrionaceae; Vibrio.
Sequence
MEINKQIRQQVITDLQTHLVDSDGQPLIAAYFSGRGEPVLASDDGEIASLEVPAISVYMV
EGEATGQDFDAEEWNAALAVEIMDLATNQLDDDLDNLGEKVLNVIHRDYTANGLLTLCNR
AGFSYVREDGAPWGSLVLTFSVEMETD
Download sequence
Identical sequences A0A2J9VC67
WP_058667910.1.63462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]