SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K0D7I2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2K0D7I2
Domain Number - Region: 125-180
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.0331
Family Nuclear receptor ligand-binding domain 0.011
Further Details:      
 
Domain Number - Region: 51-150
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0575
Family Pseudo ankyrin repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K0D7I2
Sequence length 191
Comment (tr|A0A2K0D7I2|A0A2K0D7I2_STAAU) IDEAL domain-containing protein {ECO:0000313|EMBL:PNN57735.1} OX=1280 OS=Staphylococcus aureus. GN=RK65_011070 OC=Staphylococcus.
Sequence
MSETLNQIKESFIEYLLFQYRFKSRIAVWVLNYIKVNEAKLANIHFVDTKINHHETLEIA
EVGSHASAIQFTKRNIKLMNTNEIFDYIANHNCAFDIQIHFANVSKREQRLDDLIVAQLT
ESPSYQTYLHDLNSMAIDRHKHALLIDYLLHNIDLSLQMNEKQRFYQLTQILNTLKLVNK
HNQFEDLADDN
Download sequence
Identical sequences A0A2K0D7I2 A0A2K4E2E5 Q2FYH3
gi|88195196|ref|YP_499997.1| WP_000005213.1.100665 WP_000005213.1.10543 WP_000005213.1.10583 WP_000005213.1.11287 WP_000005213.1.11492 WP_000005213.1.11665 WP_000005213.1.11816 WP_000005213.1.12005 WP_000005213.1.12181 WP_000005213.1.13303 WP_000005213.1.14366 WP_000005213.1.15000 WP_000005213.1.16455 WP_000005213.1.16569 WP_000005213.1.16672 WP_000005213.1.17289 WP_000005213.1.17657 WP_000005213.1.18658 WP_000005213.1.18968 WP_000005213.1.19788 WP_000005213.1.20210 WP_000005213.1.20649 WP_000005213.1.21621 WP_000005213.1.22045 WP_000005213.1.22859 WP_000005213.1.23580 WP_000005213.1.23902 WP_000005213.1.25095 WP_000005213.1.25633 WP_000005213.1.262 WP_000005213.1.26405 WP_000005213.1.2674 WP_000005213.1.28675 WP_000005213.1.28690 WP_000005213.1.29826 WP_000005213.1.30023 WP_000005213.1.30333 WP_000005213.1.30381 WP_000005213.1.30998 WP_000005213.1.31068 WP_000005213.1.31204 WP_000005213.1.31462 WP_000005213.1.31621 WP_000005213.1.31949 WP_000005213.1.32059 WP_000005213.1.32125 WP_000005213.1.33172 WP_000005213.1.3341 WP_000005213.1.33766 WP_000005213.1.33949 WP_000005213.1.33966 WP_000005213.1.34080 WP_000005213.1.34194 WP_000005213.1.34280 WP_000005213.1.34569 WP_000005213.1.34923 WP_000005213.1.35014 WP_000005213.1.35903 WP_000005213.1.37075 WP_000005213.1.38422 WP_000005213.1.39384 WP_000005213.1.39494 WP_000005213.1.40082 WP_000005213.1.40613 WP_000005213.1.41458 WP_000005213.1.42230 WP_000005213.1.42798 WP_000005213.1.43851 WP_000005213.1.44095 WP_000005213.1.44715 WP_000005213.1.44876 WP_000005213.1.45492 WP_000005213.1.4582 WP_000005213.1.45833 WP_000005213.1.4597 WP_000005213.1.46021 WP_000005213.1.46035 WP_000005213.1.46185 WP_000005213.1.46248 WP_000005213.1.46259 WP_000005213.1.46289 WP_000005213.1.47105 WP_000005213.1.47851 WP_000005213.1.49257 WP_000005213.1.49444 WP_000005213.1.5045 WP_000005213.1.50556 WP_000005213.1.51393 WP_000005213.1.53452 WP_000005213.1.53911 WP_000005213.1.54094 WP_000005213.1.55985 WP_000005213.1.56220 WP_000005213.1.56464 WP_000005213.1.57338 WP_000005213.1.57427 WP_000005213.1.57448 WP_000005213.1.57727 WP_000005213.1.58686 WP_000005213.1.5904 WP_000005213.1.59329 WP_000005213.1.59609 WP_000005213.1.60181 WP_000005213.1.60551 WP_000005213.1.61188 WP_000005213.1.61224 WP_000005213.1.62088 WP_000005213.1.62367 WP_000005213.1.62537 WP_000005213.1.62539 WP_000005213.1.63322 WP_000005213.1.63510 WP_000005213.1.64304 WP_000005213.1.6603 WP_000005213.1.67113 WP_000005213.1.67312 WP_000005213.1.67447 WP_000005213.1.68139 WP_000005213.1.68398 WP_000005213.1.69105 WP_000005213.1.69239 WP_000005213.1.7046 WP_000005213.1.70495 WP_000005213.1.70564 WP_000005213.1.71182 WP_000005213.1.71410 WP_000005213.1.71416 WP_000005213.1.71466 WP_000005213.1.71475 WP_000005213.1.7158 WP_000005213.1.72478 WP_000005213.1.72816 WP_000005213.1.74840 WP_000005213.1.76820 WP_000005213.1.77190 WP_000005213.1.77331 WP_000005213.1.77460 WP_000005213.1.79110 WP_000005213.1.8045 WP_000005213.1.80855 WP_000005213.1.81022 WP_000005213.1.81095 WP_000005213.1.81097 WP_000005213.1.81132 WP_000005213.1.81232 WP_000005213.1.81379 WP_000005213.1.81384 WP_000005213.1.81767 WP_000005213.1.83652 WP_000005213.1.83750 WP_000005213.1.84129 WP_000005213.1.84275 WP_000005213.1.85231 WP_000005213.1.85555 WP_000005213.1.86736 WP_000005213.1.88311 WP_000005213.1.88696 WP_000005213.1.8986 WP_000005213.1.90217 WP_000005213.1.90556 WP_000005213.1.92055 WP_000005213.1.92115 WP_000005213.1.92965 WP_000005213.1.93272 WP_000005213.1.96209 WP_000005213.1.96682 WP_000005213.1.97484 WP_000005213.1.97717 WP_000005213.1.97758 WP_000005213.1.99888 YP_499997.1.76163 93061.SAOUHSC_01479 gi|379014672|ref|YP_005290908.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]