SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K0TP33 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K0TP33
Domain Number 1 Region: 79-166,204-275
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000484
Family Pseudo ankyrin repeat 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K0TP33
Sequence length 354
Comment (tr|A0A2K0TP33|A0A2K0TP33_9HYPO) Uncharacterized protein {ECO:0000313|EMBL:PNP47296.1} OX=398673 OS=Trichoderma gamsii. GN=TGAMA5MH_01112 OC=Trichoderma.
Sequence
MTILHDRRDHIPITEGAVIAAAENQSWDKEVLGLLLNWRGDETPVTESVVKAAAGNKIKG
WRLLGMLFDWFGDQTPTSEEVVKAAAANRGDEKVMELLLDRGGPQLPITEEVIKAAAGNS
FRGEQVMKQLLFRRDQIPITVEVIKKLAENFSGFTILEVLLRQCGDQIPVTEEVVKIIAE
AFASDIMKLFLQVCGGRILITEEVMQISAREHDGEVMELLLDRCGDQIPITEETIRAAAA
ENWRGHEVIELFLDRRGDQVVVTEDLLKAAAASSSKSVKKLELLLKRRGDEVVITEEVVK
AAAGNRLKGEKVTAFLLREHGDEIIVTDDIMKAAAGNEESGEEVMALLLDHRGD
Download sequence
Identical sequences A0A2K0TP33

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]