SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K0TP42 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K0TP42
Domain Number 1 Region: 14-182
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 3.53e-22
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.00056
Further Details:      
 
Domain Number 2 Region: 374-515
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000000314
Family Pseudo ankyrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K0TP42
Sequence length 577
Comment (tr|A0A2K0TP42|A0A2K0TP42_9HYPO) Uncharacterized protein {ECO:0000313|EMBL:PNP47289.1} OX=398673 OS=Trichoderma gamsii. GN=TGAMA5MH_01105 OC=Trichoderma.
Sequence
MACFSLDETSLEFRQLRLLVAATGTRHSSWAQPLVVRLSKDRRIEMRAVVDDPSPRLNQL
VITIQNSPLGGAQLDSEGSLLRQSRLNIYDLVDWADLLVCVPLDMNSIGKMLAGVADTFL
EDLLRNWNKAEKGVIMVPGMDDSIWLSPLVQQQLDDLQRTRPCIHVMEPILWHYEDAAHP
QQATNWSGFRHLLTLIQNQADLLNLGRDVEGATRTVAVPNGTQAAPGLPFELWSKILSLT
GDWELANALGIGTNLPIPTEWDMQSGGLGNPLLVYTHELNWTILSSNTAAICAKLSEAPA
DFHILPVLAVKLIIRFALVEVLAYLEANHPRLFKAFDGAFLPTKASAYYPQIEILDYWKN
SRHFQNRHVYGTEAIDGGSKNGHVQVLQWWKQSGLPLLYTKVSLEQASSNGHIPVLDWWL
DTAARDHNITLHSGRSLLWAARNGHADVLRWWHASGISVGYEGGVALVASKYGHVHVLET
WRKLKGDENVVFDAEEVIFTATAYGRVEVLEWWRRFSQGQLDDMDGQGVEVVFRTHKIQE
AVKGNSEHKLGVQEWWFRYRLSTGNSSREGWPPHLRL
Download sequence
Identical sequences A0A2K0TP42

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]