SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K0TS72 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K0TS72
Domain Number 1 Region: 1406-1622
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.89e-27
Family Ankyrin repeat 0.00058
Further Details:      
 
Domain Number 2 Region: 151-351
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000796
Family Extended AAA-ATPase domain 0.075
Further Details:      
 
Domain Number 3 Region: 1013-1176
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000432
Family Pseudo ankyrin repeat 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K0TS72
Sequence length 1628
Comment (tr|A0A2K0TS72|A0A2K0TS72_9HYPO) Uncharacterized protein {ECO:0000313|EMBL:PNP48382.1} OX=398673 OS=Trichoderma gamsii. GN=TGAMA5MH_00666 OC=Trichoderma.
Sequence
MFYERFTIDSSRIICVYETQMTPTVEWSVKTASWERTGQKVMMVPHTSATHVSKNEKAYD
HLPIDADHSDIVKFHNPSNQDYAIIEARIRQLTDQALPIVKSRFISHQKKLSALESQYIN
ALNSPTYDWFRHGKVDDPAPGTLRWFLREKQFLSWKDSNESSILWIRGSAGQGKTVLAKF
LLDHLERATSDSGSKPTIIYFFFYDQDQNLRTVDAALRSLIKQLILHRRGLAFQVISEKF
DIESQVIPEYILWRVLEELLRTSIFGTIYCVFDALDECRDDSPTPRLPDFFSKLVKSSSI
SKPTDLVIKALMISRPKVELSRVLEQHPFIHLKANPQDLEAFIRSQIEKIGLSDDLHGNA
IRLLTSRAGQTFIWISIVLKKIKAVTSPLSEVDMEKIITQSPSDLTALYEDIMTQVMRSE
NSIQQKLLAWVVYGQQALTLPELQEALSVQYDSSSAESAKKHMIRLTEYVVTSVAILEIS
LGRVYLIHQSAKDFLLVSGHLAAAEFCRILRPSAYLGRICMVYLCFSEFKSGSCRDRVEL
DQRIRQYPFLRYAARNWHRHIQAEDDISGFASIIRQVTEPKSPTLQAWGEVAGILDLDKA
ENVWDIATRAHIPWLPELSEFRARGTTVDQSRVKLAASSGLAGSDALSALVRRGNVQFTN
EAAQAIARYCDQEMMQSFLESSRRVIVTPSLMRAAAANDKYGASVIRLLLKSLDDFVITD
DFVLKLQTNHACRHDIMEFLLHENVKISNEALANLVKIFGAKILKFVQSSQWDDTLITEA
VVAAAAGCADGEEAMTLLLEQREKEIEITEEVLKAAASNDYYSRGVMELLLKRVGRAEIT
EDVVKAAAKQWEKSMEIISHLLEERKGDILITEDILQTAVRNYKNGKALAEILLEGNDNK
IEITEDIAKASTISPSNGRAIITLFLGKSGSKHNIPEEVLEAVVGYSGSGALITWLFEQH
GDKIHLTEPVVVAAASSFDADEAFALLLEYRGNEIKFTENVVKAAAKSYYGSTRLMASLL
ETHGNEIEITEDVLIAVAENDSTGHATMRNLLDRRPKEVKITERVMKAAASNQSSPELLS
LLLKERGDEVRVTENIAKAAAANRHGRLPMALLLEKRGSEFQITEDVVKVAARNYSSDVL
TFLLEKYGNQIKITEEVIEAAARSYHKEAVGLLLEKCDSDVKITEDMIKAVVGSTINCTL
VMTMLFEKYGSKIEITEDVVITAAGNDNNTAPILTLMLRKSNAKITERITKAMAKNSSCG
RAMMLWLLDKYGSEIEITEDVVIAAAENRENSRAVLALLFQKRGGEIKITEKIIKAAAEN
SRAALLFLLEKFGSEIRITESIVKAAARNSGSGRAVMLLLLQTYGEMVQITEDVILAAVG
RGRGSRSVMQLLFKERGSDIKITEQVMKAAVQNNRGVTALLLEERGDEIEITEDILIAAA
ANVNHGEEVMDLLLDKRLSDVSALIQDSVCLAAAASGRHKVLNLLCNRHGFLPLRKEWTA
IATFFNAAKDGDVAAVRRLLKEGVDPDVKNADSTLVTPLWAAAWYGNTAIVELLTQRKDV
DVNILSDAGRSPIYGPAVSGYGAIVKLLIAAGAKVDFVDKDGDTPASVARNYGHGRVAEM
LERVSSER
Download sequence
Identical sequences A0A2K0TS72

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]