SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K0W053 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2K0W053
Domain Number - Region: 35-107
Classification Level Classification E-value
Superfamily CAPPD, an extracellular domain of amyloid beta A4 protein 0.0235
Family CAPPD, an extracellular domain of amyloid beta A4 protein 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K0W053
Sequence length 207
Comment (tr|A0A2K0W053|A0A2K0W053_GIBNY) Uncharacterized protein {ECO:0000313|EMBL:PNP75654.1} OX=42673 OS=Gibberella nygamai (Bean root rot disease fungus) (Fusarium nygamai). GN=FNYG_11063 OC=Fusarium; Fusarium fujikuroi species complex.
Sequence
MACECEAKGLDVAVKQAEDRMMRSIYNEIRSWVRGHAQDYILEYFRLLTDQRKTAHAAHM
DRITAHAYHYYHAPPHPTQVAEAQASLKRGIDEDWQASVQRYPEVLEYFFGLVELTLPAE
DEPAVKDPPLGSLSNSRKVNRRSGTAPPGASAVVAPPGYRGDPGQMHPQEPPMPRPDRRT
PGPQMRRPNFGAIPPPMPGAYNFPPPY
Download sequence
Identical sequences A0A0D2XWE5 A0A1L7TV29 A0A2H3HUT5 A0A2H3S8R9 A0A2H3T8L7 A0A2K0W053 F9FE33 S0DRR6
FOXG_08311T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]