SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K1JN02 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K1JN02
Domain Number 1 Region: 185-473
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 6.39e-126
Family Enolase 0.00000000414
Further Details:      
 
Domain Number 2 Region: 47-179
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.69e-58
Family Enolase N-terminal domain-like 0.00000272
Further Details:      
 
Weak hits

Sequence:  A0A2K1JN02
Domain Number - Region: 3-41
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00863
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K1JN02
Sequence length 476
Comment (tr|A0A2K1JN02|A0A2K1JN02_PHYPA) Uncharacterized protein {ECO:0000313|EMBL:PNR42925.1} OX=3218 OS=Physcomitrella patens subsp. patens (Moss). GN=PHYPA_017757 OC=Physcomitrella.
Sequence
MSVQEYLEKHKLSSRIEDAVNAAVRAKSPDPVIFIADHLRKAVPGVITKVHARQIIDSRG
NPTVEVDVWTGKGMFRAAVPSGASTGVHEAVELRDGDKNVYMGKGVLKAVANVNDKIQPA
ILGMDPREQAKIDRTMMELDKTENKGSLGANAILAVSMAVCKAGACEKGVPLYQHIADLA
ENTRLVLPVPAFNIINGGSHAGNKLAMQEFMILPVGAPSFSEAMRYGTEVYHHLKAVIKA
KYGIDACNVGDEGGFAPSIASNKEGLDLVKMAIEKAGYSGVVKIGMDVAASEFYTSDKKY
DLDFKTPNNSGADVKSGDEMIAMYQSFCKDYPIISIEDPFEQDDWENTKKLTDLKICQVV
GDDTLVTNPKRVAKAIEEHTCNALLLKVNQIGTITEAIEAVNMSKKAGWGIMASHRSGET
EDSFIADLAVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGDKAAYAGENWRPKL
Download sequence
Identical sequences A0A2K1JN02
PP1S37_237V6.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]