SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K1NB35 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K1NB35
Domain Number 1 Region: 5-92
Classification Level Classification E-value
Superfamily TPR-like 5.06e-17
Family Tetratricopeptide repeat (TPR) 0.0077
Further Details:      
 
Weak hits

Sequence:  A0A2K1NB35
Domain Number - Region: 65-140
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0589
Family Pseudo ankyrin repeat 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K1NB35
Sequence length 149
Comment (tr|A0A2K1NB35|A0A2K1NB35_9BACT) Uncharacterized protein {ECO:0000313|EMBL:PNR87748.1} OX=1434329 OS=Petrotoga sp. 9T1HF07.CasAA.8.2. GN=X925_08120 OC=Bacteria; Thermotogae; Petrotogales; Petrotogaceae; Petrotoga.
Sequence
MSKELAYYYNQKANTMLEKGNYLNAASYYKKAISLLPEDPMFYHNIGVCYMLSEDYEKAS
KFLEIALEKGIDLDETNLYLAHSLYEIEKYEDILHLKEPQDGQNKINFLIIKSKAALKSG
NNEVAKKIVSHLKISGYNSQELELIEKMI
Download sequence
Identical sequences A0A2K1NB35 A9BGR8
WP_012209405.1.6947 403833.Pmob_1614 gi|160903050|ref|YP_001568631.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]