SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K2ER43 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2K2ER43
Domain Number - Region: 44-147
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00484
Family Pseudo ankyrin repeat 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K2ER43
Sequence length 153
Comment (tr|A0A2K2ER43|A0A2K2ER43_COXBE) Uncharacterized protein {ECO:0000313|EMBL:PNT89002.1} OX=777 OS=Coxiella burnetii. GN=C2L89_00725 OC=Coxiellaceae; Coxiella.
Sequence
MTVNKSLILLLDNRRICSFNVLKQGVVMMRRSSAESKETETMLAIVHDAVKQGDVPALKE
IDELGFPLEGEVYEKTDLPMVVAIKAKQFAVVNWLKKKGVNRVLFSGERNTQAADDFSIV
SALKILSAIFEIKDIKAIKAFLQGVNLNVYHYS
Download sequence
Identical sequences A0A2K2ER43 Q83D80
227377.CBU_0860 NP_819879.2.72601 WP_010957855.1.15899 WP_010957855.1.20088 WP_010957855.1.39746 WP_010957855.1.53098 WP_010957855.1.55635 WP_010957855.1.56161 WP_010957855.1.68745 WP_010957855.1.68840 WP_010957855.1.73073 WP_010957855.1.88235 WP_010957855.1.8942 WP_010957855.1.92481 WP_010957855.1.96664 gi|215919060|ref|NP_819879.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]