SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K2SVD6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K2SVD6
Domain Number 1 Region: 12-427
Classification Level Classification E-value
Superfamily MFS general substrate transporter 2.75e-43
Family LacY-like proton/sugar symporter 0.025
Further Details:      
 
Weak hits

Sequence:  A0A2K2SVD6
Domain Number - Region: 429-458
Classification Level Classification E-value
Superfamily Multimerization domain of the phosphoprotein from sendai virus 0.0824
Family Multimerization domain of the phosphoprotein from sendai virus 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K2SVD6
Sequence length 468
Comment (tr|A0A2K2SVD6|A0A2K2SVD6_SALCE) Permease {ECO:0000313|EMBL:PNV49751.1} OX=1444294 OS=43481. GN=Z996_15905 OC=Enterobacteriaceae; Salmonella.
Sequence
MDKGRLSVREKIGYGMGDAGCNIIFGAIMLFVNYFYTDIFGLAPALVGVLLLSVRVIDAV
TDPVMGALADRTQSQYGRFRPWLLWVAFPYALFSILMFTTPDWSYNSKVVYAFVTYFLLS
VTYTAINIPYCSLGGVITNDPKERVACQSYRFVLVGIATLLLSLTLLPMVDWFGGGDKAK
GYQLAMTVLAIIGMGMFLFCFASVRERVRPAVPTHDDMKNDFKDVWKNDQWVRILLLTLC
NVCPGFIRMAATMYYVTWVMGQSTHFATLFISLGVVGMMIGSMLAKVLTDRWCKLKVFFW
TNIVLAIFSCAFYFFDPKATVMIVALYFLLNILHQIPSPLHWSLMADVDDYGEWKTGKRI
TGISFSGNLFFLKLGLAIAGAMVGFLLSWYGYDASAKTQSASAMNGIMLLFTVIPGIGYL
ITAGVVRLLKVDRELMKQIQDDLEKRRTNYRELSELQELNAAESVRKA
Download sequence
Identical sequences A0A1M3YA86 A0A2K2RX84 A0A2K2SDE5 A0A2K2SRM7 A0A2K2SVD6 A0A2K2T2C7 A9MQ95
CP000880|CDS_2769354-2770760 41514.SARI_02846 WP_000357546.1.100979 WP_000357546.1.1204 WP_000357546.1.13465 WP_000357546.1.1832 WP_000357546.1.18796 WP_000357546.1.20438 WP_000357546.1.2155 WP_000357546.1.22026 WP_000357546.1.26414 WP_000357546.1.27123 WP_000357546.1.2974 WP_000357546.1.45947 WP_000357546.1.49041 WP_000357546.1.52052 WP_000357546.1.64036 WP_000357546.1.64715 WP_000357546.1.65308 WP_000357546.1.70262 WP_000357546.1.70692 WP_000357546.1.73242 WP_000357546.1.74673 WP_000357546.1.75150 WP_000357546.1.80363 WP_000357546.1.90617 WP_000357546.1.9276 WP_000357546.1.98266 WP_000357546.1.98558 gi|161504723|ref|YP_001571835.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]