SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K3CN29 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K3CN29
Domain Number 1 Region: 85-159
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000196
Family Pseudo ankyrin repeat 0.03
Further Details:      
 
Weak hits

Sequence:  A0A2K3CN29
Domain Number - Region: 521-571
Classification Level Classification E-value
Superfamily Carbon-nitrogen hydrolase 0.0872
Family Carbamilase 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K3CN29
Sequence length 761
Comment (tr|A0A2K3CN29|A0A2K3CN29_CHLRE) Uncharacterized protein {ECO:0000313|EMBL:PNW69689.1} OX=3055 OS=Chlamydomonas reinhardtii (Chlamydomonas smithii). GN=CHLRE_24g755247v5 OC=Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas.
Sequence
MNPSEVSGALKLLNKASAEWLKGSPEFRKIRLAMRVPKWCSYNGKKIQNEYVVVAAQPWP
RGAFLAHWGRPEPWRSLTLVERRRLLALAASSGDADSLDAALAHCGCSLTKDVFTAAAAA
GRLAACRRLLAQGCDVDYAAALVAAAGAGLEQFTQLLELVQMDMKHLRAVGGVACHCGHA
QLLQAIVIILEAGGNTPKADMILDWAAAAAHGGQVELLDRLEPLMSRPDRQCALDDTIVA
ASSGSGSSQPVPLEVRRDIVLDHIAHGCGLEVLQRYYAQWAWAAPHPGQPSMERHLFMEM
VAAAAGSPTPDAFEKVDWLLEQLAAAGGAAGGAAGGAAGGAAGGAAGGAAGGAAGGAAGG
AAGGPDGGPGGGPGGGDGNGPPALLPPGVYLSVEALGRRPDFLKRLQQLERRGFSDFAGA
AAVAARTGHADALAYLLTDKHVRPSAKLVDDAERSAHLPVLRLLRQRGLGLSAAVHSKPE
LLRVLPVEWVAEAVAAARQQQQQQQQHRGTAPGGEDPDGEVRRLFRSAAAAGAGLAVLRE
LHACGVPIDLRAVAVGGSEEALEWAAAALREEEEKGGAAIQIVSREDLWNVLCAGYPRKD
PEEDRDPVQALCGVFPWDHTNGNLAAAAWLQAHRLACLLDLPFLRSKFSRLQSWEPLPAL
HLARISAGYQKLQWALAQVGWERLSAADWRDVRSCLGWSNYPEGEPVGQVASRHQRDAWE
QWRREAAAAGAAGAAAAGATDLQREEDTEPREVDELGSWKM
Download sequence
Identical sequences A0A2K3CN29
jgi|Chlre4|294180|au.g11954_t1 3055.JGI294180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]