SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K3CWE0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K3CWE0
Domain Number 1 Region: 95-169
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000968
Family Pseudo ankyrin repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K3CWE0
Sequence length 734
Comment (tr|A0A2K3CWE0|A0A2K3CWE0_CHLRE) Uncharacterized protein {ECO:0000313|EMBL:PNW72595.1} OX=3055 OS=Chlamydomonas reinhardtii (Chlamydomonas smithii). GN=CHLRE_15g635300v5 OC=Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas.
Sequence
MASARTIMWLRLTPELKQHIASYLPENDAAANLKLADRDTAAALRGLYCNITLSEQQESE
WVPRVCKPWPSADFVAHWGRPEPWRALTLPQRQRLLCLAASSGHAPSLDAAIANCGCMLT
PNALTAAAAAGNLAGCERLLASHCECSAAARNAAVMAGHLQLLQLLLESAPKYLIVQTLD
ELARTACMYGQAHILTWLRRARGFKPHFYHAMAAARGGHVRLFEELVPDRLVMDCGLRVP
VVEAAAGDATGQAVPEEQRPVQGDRVGDSSDAAAQEGPALVLERWRVLDALVLGCPVEVV
RRYHHRLWSPPPEQVAAAVAAAEAEAAAAAAAAMPGGRQAAAAAATVVRHTESSVITWLH
LARQLFASALRSRTPCWAAKVQYLLGAWGPVVAGQVLGGKEVVVAGPTGAVLWRGERGRE
VALAAAVHHPEILLRFRHAHADGLASRHSDAVRGVLQRGDAAALAYLWDVCGVAARLGDT
WDPLVVRDAYLGWGHVAVLQLLQERGYGFTAADVEREAWGQGTSTGMCCGFDMGMGYSSS
SDCHSRADAALVWLTQVAAPCGAGAGAGGGGGAGAGAGAGAGAGAGAGAGAGAGAGAGAE
AGAGAGAGAGAGASASDSGTGTGTGVRGERHCWSAAFRHAARRGATLPVLKALRARGAAI
SLAAVACGGSEETLEWAVAELAAERGCRPRALRGDAAVSLMDGPNAATRDWLLREGLLRT
AGPWEEAASEEEGE
Download sequence
Identical sequences A0A2K3CWE0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]