SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K3CWK3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K3CWK3
Domain Number 1 Region: 105-208
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000248
Family Pseudo ankyrin repeat 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K3CWK3
Sequence length 585
Comment (tr|A0A2K3CWK3|A0A2K3CWK3_CHLRE) Uncharacterized protein {ECO:0000313|EMBL:PNW72664.1} OX=3055 OS=Chlamydomonas reinhardtii (Chlamydomonas smithii). GN=CHLRE_15g637700v5 OC=Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas.
Sequence
MLSSSALCLLKGPEATEAAAQRGNIGVLRMLLARRDAAAAAAAAAYLSAGGGAGGAGAAA
AAAVGGTVNEAAAAAAAAAEGRRKASLRFGLRDHWGYGGPVSGVIAGGHLEVLKLMHANG
CTFDVKSSGHAAIRAGNLEILQWLTNTFANARTFDRHCYIIHRHSPMDHHDAPASQLDFV
GEGLIGTAAAAPRAVQVLNWLQAHGVADSRVWGKYSLQGAVQGGGSVAGVLWLTRRGCPD
WDLSELDATEMYCGAARHGDIGMLRLLCRVLRLPYDLVRCNSWGTPLQPLFVQAVQKGAE
LRSLKWLAGCGAAEGRWQAAVDAAVETARSWAGTWGKVAEGGADTNHGYQRRPYEGLLSA
CRKGLATAEALRWLLERGEQAAAAAAAAAAAVAVAAAEAAVGAMGARSELPAATAVAAAA
ATVVAAAATAATAATAAANEAPENGGRSSPVGGGGSGGVGGGVGSGGGCSSRRGWQVAVR
RSLFSMGSGGRDGGSGGGGGGGYGGGGAEGGGSVGLPAPAEAAPTAAGGGAVTTAANSNK
RSVNCAAMGTAIEGTEGTVAAAETAAADAAAVVGLGWVIWELPEA
Download sequence
Identical sequences A0A2K3CWK3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]