SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K3D046 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K3D046
Domain Number 1 Region: 181-255
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000128
Family Pseudo ankyrin repeat 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K3D046
Sequence length 1036
Comment (tr|A0A2K3D046|A0A2K3D046_CHLRE) Uncharacterized protein {ECO:0000313|EMBL:PNW73908.1} OX=3055 OS=Chlamydomonas reinhardtii (Chlamydomonas smithii). GN=CHLRE_13g577700v5 OC=Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas.
Sequence
MMPHQTYFAYSGKTGRVALSTSSRIGGHIGGSGQPAAKRRRLDSAWAPTEEHSSSSWRCE
CTACCRPKSALEALPAELLDRISQSLSPNEVTCTLRLLSRTLAAHFRSRTTVQLWQPVPH
HAFVRRFGRWSAVRSMPLAQRRKLIALTATSGSLENLRVVAGGPDVTQAVGTAGCALTAE
VFTAAAAAGQLHVCKELYSMGCPWDTSAVEAAARLGDVRLVRAIVRSGCRWDFPRALSAA
AAGGSWEAVEVLMDLQERGPHYTGGEWRDYNEDGESEEEEEEEEEEEDEDEEGEEEEEKE
EGEKQDLESAGKPAGGCAAADTAAQGGVAAAAGLSPPKQPVAQPKATAAAAVEADPDEGL
ADAAARAAAAAADIAAVQRYPPFPKSRDWSDVTCAAAWGLSLEVMVELAVRCGAAEGENS
TDMHGFDLAHAIATALLSPTPDWRAKAQWLQNHCPDVARAAAEAARAAEESATVAAPESR
GRGRSRRHELFWLVVPYAAKAGWHPINGQLPPLSALRPEQLLPRMAWARRRGYSVTMPPP
EVLPLSDTAAVRAVLAWVLEDEQQWPSHAGSCCHTHFFICAAARGGHVGALQAVAAEEHR
AAGAAGRVPAAGNVAAAAGSSDGAPATGGEQGHAGAGQGTAGRPVWRPGWAERAAKEAAE
AGQVPVLQWLVDTWGGEAILSEKLWRSAAEAGPHAARVFEWLMRVACPGSLGSGDAAGAV
RHAGASGLALFRWLRQRRCAFGEGVMQAAVEAGNVRLVEALRGAGCALGPALWKPALEKG
HVEVADWLWRRGCPLPEEVPYWRPFLPERVALQTPEPLYTAAIVNGDLGMLQELWQRVEE
SEADVAARRGRRVALPQLAYNLCSALWKGSGPEACRSLPLIRFVLHKTAQPPSMDWTKQI
VYSWRNVKAYQTWEGPDQPYTAVTADVYDDWVAKLLARFEEWRKLAKLAEGVRESHELRV
HVDKYGGGTGGSLVAASLHASRTHLTAAVEASWAEICATVERVLEWDLYKGEEEEEEEEE
EELEEEEEEQRAEGFK
Download sequence
Identical sequences A0A2K3D046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]