SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K3DZB2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K3DZB2
Domain Number 1 Region: 137-219
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000157
Family Pseudo ankyrin repeat 0.029
Further Details:      
 
Domain Number 2 Region: 567-673
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000348
Family Ankyrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K3DZB2
Sequence length 901
Comment (tr|A0A2K3DZB2|A0A2K3DZB2_CHLRE) Uncharacterized protein {ECO:0000313|EMBL:PNW85886.1} OX=3055 OS=Chlamydomonas reinhardtii (Chlamydomonas smithii). GN=CHLRE_03g201301v5 OC=Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas.
Sequence
MEAQHPNSAKAGSVSCGGPSSAPAATPDLAADPSRVWLPELVQRIATFLPRNAIPCILRL
VDSATAAQFSGWKHRTIHLSEPVPHGLFAARWSPPRATRNLPLELRCRLVALTAASGVVE
NMPVALAAAGCLVQPALLGYAAAAGQVKMCAWLHINGCPAVKMDDELDVLALAAARGHKE
VCEWLLANRYGWSWDALCAAAGGGHVELMLWLWRQGPGAAGAGAPVAAPPAPAAGTVAGT
AVPEESRTAGTSSTSSDAAIYTGADGAAVEADEWHAAAQAVLGGIPVDMQLLQEVAAGCD
VGTLRAAHTVWHAADQRAQQARREELRRQQQQRRDRRQEERRLSRERYGQHDADPLGVGE
PSDEDLDAEDALEVAAAEELPFDERKLRERVMGAAAGSPTPCWRKKVAFLEDVGFAKCTA
ACEWAAAVEVEGTRQHRPPIVPSVLPAVLPLLSGAASSGGKEATAGGAAAAPAALAVAGA
SAAVVTSAAAAESEAAGAAAAAALLFDLDDLSDSESEPEPDVNKCEKDPSAGDGAGTDAE
SSQSGTDDALTRLRWLRRRGYPADGAAVIEAAQHGNTAALAFLLHRCDATPRWEAADAAA
EGGHLGCLRLLRAARATMGQHTLSRAAQRGRLRVVRWLAERADLGVLLDADDDSIMSAAA
GSGCVPLLAYLRGVQQLSGCSGGGEYGSGGGGAGALRGCKSRASGDAAQGGGEEGGERGK
KAGEAEGEGGRGAAGAGREGQWMCPWDEDTFAWAADGGCEEAIEWMAAHGCPMGVDGLPY
VWAGINGDFATLACLRRLGCPWDPQGGTFLRALRSHRRGRWCSVPALQWLLGEGCPVGDW
EALLKAARVRGRDYMEVVNWVERVKKKQEEQAATGGGGVEGKSEETSPRPASGCVPCCLG
R
Download sequence
Identical sequences A0A2K3DZB2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]