SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K3JJ40 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K3JJ40
Domain Number 1 Region: 2-136
Classification Level Classification E-value
Superfamily MTH1598-like 7.06e-39
Family MTH1598-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K3JJ40
Sequence length 136
Comment (tr|A0A2K3JJ40|A0A2K3JJ40_9EURY) Archease {ECO:0000313|EMBL:PNX54034.1} OX=1933280 OS=Thermoplasmata archaeon M9B2D. GN=BV458_01185 OC=Archaea; Euryarchaeota; Thermoplasmata; unclassified Thermoplasmata.
Sequence
MRHYELIEHTADVGVKAYGTTLAEAFEHAAEGMFDIITDESSIKPTGEYQILLEAADLEQ
LLVDWLSQLLFLNGAYDLVFGTFQVTLKGTCLSARVFGEKYDTKQHRMGVEIKAVTYHML
QVHEGAPIFVQVLFDI
Download sequence
Identical sequences A0A2K3IU49 A0A2K3JJ40

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]