SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K3LHB2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K3LHB2
Domain Number 1 Region: 12-112
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000654
Family Pseudo ankyrin repeat 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K3LHB2
Sequence length 179
Comment (tr|A0A2K3LHB2|A0A2K3LHB2_TRIPR) Uncharacterized protein {ECO:0000313|EMBL:PNX77903.1} OX=57577 OS=Trifolium pratense (Red clover). GN=L195_g033875 OC=Trifolieae; Trifolium.
Sequence
MRDDLGDTALALVASYTGNIDMAKCMVETKKGSRESLLVLPNRRSEIPVILAAAKGYKEM
TRYLYSKTPVTALDYSSQSRLKLLDGCITAHIFDVALSLLKRYPDLFIEASSEQLESSEF
PDSSLTFLCXTYLLKLRPNNWNQVNSRTLLSLSFANSQPHCLKWHRLSQVAADSDFQKN
Download sequence
Identical sequences A0A2K3LHB2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]