SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K4CP64 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2K4CP64
Domain Number - Region: 27-62
Classification Level Classification E-value
Superfamily YfbU-like 0.00327
Family YfbU-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K4CP64
Sequence length 102
Comment (tr|A0A2K4CP64|A0A2K4CP64_STACP) DUF1033 domain-containing protein {ECO:0000313|EMBL:PNZ76385.1} OX=72758 OS=Staphylococcus capitis subsp. capitis. GN=CD038_09170 OC=Staphylococcus.
Sequence
MWTVAKMRADYEGWWLFSDWPERVIETLNFNTYEEMLEKYTKLLQDCKDCFDNYVVGKHN
IYAFYNNCDLNFCEDCDEDLQIFYSFIILKNNEVYFNLPKID
Download sequence
Identical sequences A0A269WL62 A0A2K3VHB8 A0A2K4CP64
WP_002433682.1.10686 WP_002433682.1.20118 WP_002433682.1.32120 WP_002433682.1.32743 WP_002433682.1.34513 WP_002433682.1.5010 WP_002433682.1.51158 WP_002433682.1.5176 WP_002433682.1.6659 WP_002433682.1.78754 WP_002433682.1.86382 WP_002433682.1.88190 WP_002433682.1.99845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]