SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5ASU3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5ASU3
Domain Number 1 Region: 4-56
Classification Level Classification E-value
Superfamily Preprotein translocase SecE subunit 0.00000000000811
Family Preprotein translocase SecE subunit 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K5ASU3
Sequence length 61
Comment (tr|A0A2K5ASU3|A0A2K5ASU3_9ARCH) Uncharacterized protein {ECO:0000313|EMBL:SPC34713.1} OX=2058097 OS=Candidatus Nitrosocaldus cavascurensis. GN=NCAV_1548 OC=Candidatus Nitrosocaldaceae; Candidatus Nitrosocaldus.
Sequence
MLARIENRLREMYNTLKLTKKPDREEYNIHLRMLLLGLGVVGVLAFIIQLIATYITLTFG
G
Download sequence
Identical sequences A0A2H5V948 A0A2H5VCN8 A0A2K5ASU3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]