SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5CPQ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5CPQ5
Domain Number 1 Region: 44-96
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000000419
Family TNF receptor-like 0.005
Further Details:      
 
Domain Number 2 Region: 101-144
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000751
Family TNF receptor-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K5CPQ5
Sequence length 155
Comment (tr|A0A2K5CPQ5|A0A2K5CPQ5_AOTNA) TNF receptor superfamily member 1B {ECO:0000313|Ensembl:ENSANAP00000010679} KW=Complete proteome OX=37293 OS=Aotus nancymaae (Ma's night monkey). GN=TNFRSF1B OC=Platyrrhini; Aotidae; Aotus.
Sequence
MAPAAVWAALAVGLQLWAAGHALPTKVTFTPYTPKPGSMCQINEYYHQTAQRCCSQCPAG
QHAKVFCTRTSDTVCDFCENSTYTELWNWLPECLSCGSPCSSDQVETQACTQQQNRICAC
MPGWYCALGKQEGCRLCSPLRKCGPGFGVAKPDLS
Download sequence
Identical sequences A0A2K5CPQ5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]