SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5D9B5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5D9B5
Domain Number 1 Region: 216-338
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.55e-26
Family cAMP-binding domain 0.0000179
Further Details:      
 
Domain Number 2 Region: 121-209
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000000000196
Family cAMP-binding domain 0.000033
Further Details:      
 
Domain Number 3 Region: 2-44
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000000915
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K5D9B5
Sequence length 348
Comment (tr|A0A2K5D9B5|A0A2K5D9B5_AOTNA) Uncharacterized protein {ECO:0000313|Ensembl:ENSANAP00000017528} KW=Complete proteome OX=37293 OS=Aotus nancymaae (Ma's night monkey). GN= OC=Platyrrhini; Aotidae; Aotus.
Sequence
RSHIQIPPGLTELLQGYTVEVLRQQPPDRAEFAVDYFTRLREARGPASVLPTRATPRQSP
GHPTPEPGPDHVADANGDSESEEDEDLEVPVPSTFDRQVSVCAETHNPDEEEEDTDPRVI
HRKTDEQRCRLQETCKDILPFKNLDQERLSQVLDAMFERIVKADDHGSFGDLALMHHTPR
AATIVATSEGSLWGLDRVTFRRIIVKNNAKERKVFESFIESIVDVIGEKIYKDGERIITQ
GEKADSFYIIESGEVSILIRSKTKSNRDGGNQEVEIARCHKGQYFGELVLVTNKPRAASA
YAVGDVKCLVMDRLLGPFMDIMKRNLSHCKKRLVKMFGSSMDLGNLGQ
Download sequence
Identical sequences A0A2K5D9B5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]