SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5D9E2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5D9E2
Domain Number 1 Region: 206-309
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 8.51e-16
Family cAMP-binding domain 0.0000597
Further Details:      
 
Domain Number 2 Region: 111-199
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000000000000812
Family cAMP-binding domain 0.0000265
Further Details:      
 
Domain Number 3 Region: 2-45
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000000222
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K5D9E2
Sequence length 319
Comment (tr|A0A2K5D9E2|A0A2K5D9E2_AOTNA) Uncharacterized protein {ECO:0000313|Ensembl:ENSANAP00000017567} KW=Complete proteome OX=37293 OS=Aotus nancymaae (Ma's night monkey). GN= OC=Platyrrhini; Aotidae; Aotus.
Sequence
MESHIQIPPGLTELLQGYTVEVLRQQPPDRAEFAVDYFTRLREARGPASVLPTRATPRQS
PGHPTPEPGPDHEDEDLEVPVPSTFDRQVSVCAETHNPDEEEEDTDPRVIHPKTDEQRCR
LQEACKDILPFKNLDQERLSQVLDAMFERIVKADDHGSFGDLALMHHTPRAATIVATSEG
SLWGLDRVTFRRIIVKNNAKERKVFESFIESIVDVIGEKIYKDGERIITQGEKTKSNRDG
GNQEVEIARCHKGQYFGELVLVTNKPRAASAYAVGDVKCLVMDRLLGPFMDIMKRNLSHC
KKRLVKMFGSSMDLGNLGQ
Download sequence
Identical sequences A0A2K5D9E2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]