SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5HQ30 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5HQ30
Domain Number 1 Region: 6-47
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000000000811
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K5HQ30
Sequence length 379
Comment (tr|A0A2K5HQ30|A0A2K5HQ30_COLAP) Calcium binding tyrosine phosphorylation regulated {ECO:0000313|Ensembl:ENSCANP00000006440} KW=Complete proteome; Reference proteome OX=336983 OS=Colobus angolensis palliatus (Peters' Angolan colobus). GN=CABYR OC=Catarrhini; Cercopithecidae; Colobinae; Colobus.
Sequence
MISSKPRLVIPYGLKTLLEGICRAVLKTNPSDIKQFAAAYFQELTMYRGNTTVDIKDLVK
QFHQIKVEEWSEGTTPQKKLECVEEPEKTSVESKVPTQMEKSTDTDEDNVTRTEYSDKTT
QFPSVYAEPGAEQTEAVGDSSSKPATPKATTPPSSPPPTAVSPEFAYVPADPAQLAAQML
AMAASERGQPPPYSNMWTLYCLTDKNQQGHPSPPPAPGPFPQATLYLSHPQDPQFLQHPP
KATFPTYVMGDTMKTSAPPFILVGSNVQEAQGWKPLPGHALVSQSDVLRYVAMQVPIAVP
ADEKFQKQTLSPHSANPPSGQDVPRPKSPVFLSVPFPLEDVAKKSSGSGDKCAPFGSYGI
AGEVTVTTAHKVRKAETEN
Download sequence
Identical sequences A0A2K5HQ30
XP_011794651.1.43180 XP_011794652.1.43180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]