SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5IIK4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5IIK4
Domain Number 1 Region: 4-65,104-224
Classification Level Classification E-value
Superfamily Proteasome activator 6.93e-68
Family Proteasome activator 0.0000000157
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K5IIK4
Sequence length 233
Comment (tr|A0A2K5IIK4|A0A2K5IIK4_COLAP) Proteasome activator subunit 1 {ECO:0000313|Ensembl:ENSCANP00000016297} KW=Complete proteome; Reference proteome OX=336983 OS=Colobus angolensis palliatus (Peters' Angolan colobus). GN=PSME1 OC=Catarrhini; Cercopithecidae; Colobinae; Colobus.
Sequence
MATLRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAP
LDIPVPDPVKEKEKEERKKQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKILVLLQRLKPE
IKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSE
RGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYVRRLCYMTSS
Download sequence
Identical sequences A0A2K5IIK4
XP_011786173.1.43180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]