SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5J772 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5J772
Domain Number 1 Region: 10-50
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000034
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0057
Further Details:      
 
Domain Number 2 Region: 30-122
Classification Level Classification E-value
Superfamily EF-hand 0.00000736
Family Polcalcin 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K5J772
Sequence length 131
Comment (tr|A0A2K5J772|A0A2K5J772_COLAP) EF-hand calcium binding domain 10 {ECO:0000313|Ensembl:ENSCANP00000024764} KW=Complete proteome; Reference proteome OX=336983 OS=Colobus angolensis palliatus (Peters' Angolan colobus). GN=EFCAB10 OC=Catarrhini; Cercopithecidae; Colobinae; Colobus.
Sequence
METSNRELQAAEYLERHRIKELVSYLTSALLFFRPEKPREYLISLLERLRIAKVTGVAFP
FFMDNSNIVAMFEMMDSSGRGTISFVQYKEALKTLGLCTEDGDLKDDGHIITLDKFKEEV
NKRMKEIWSAF
Download sequence
Identical sequences A0A2K5J772 A0A2K6Q271
XP_010378893.1.97406 XP_011812248.1.43180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]