SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5JR27 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5JR27
Domain Number 1 Region: 237-389
Classification Level Classification E-value
Superfamily C-terminal domain of adenylylcyclase associated protein 2.62e-64
Family C-terminal domain of adenylylcyclase associated protein 0.000000371
Further Details:      
 
Domain Number 2 Region: 45-151
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 1.1e-34
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K5JR27
Sequence length 391
Comment (tr|A0A2K5JR27|A0A2K5JR27_COLAP) Cyclase associated actin cytoskeleton regulatory protein 2 {ECO:0000313|Ensembl:ENSCANP00000031297} KW=Complete proteome; Reference proteome OX=336983 OS=Colobus angolensis palliatus (Peters' Angolan colobus). GN=CAP2 OC=Catarrhini; Cercopithecidae; Colobinae; Colobus.
Sequence
MANMQGLVERLERAVSRLESLSAVSHRPPGDCGEVNGVSGGVAPSVEAFDKLMNSMVAEF
LKNSRILAGDVETHAEMVHSAFQAQRSFLLMASQYQQPHENDVATLLKPISEKIQEIQTF
RERNRGSNMFNHLSAVSESIPALGWIAVPPSSHCHRPPPLFENEGKKEESSPSRSALFAQ
LNQGEAITKGLRHVTDDQKTYKNPSLRAQGGQTRSPTKSHTPSPTSPKSHPSQKHAPVLE
LEGKKWRVEYQEDRNDLVISETELKQVAYIFKCEKSTLQIKGKVNSIIIDNCKKLGLVFD
NVVGIVEVINSQDIQIQVMGRVPTISINKTEGCHIYLSEDALGCEIVSAKSSEMNILIPQ
DGDYREFPVPEQFKTAWDGSKLITEPAEIMA
Download sequence
Identical sequences A0A2K5JR27

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]