SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5KM20 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5KM20
Domain Number 1 Region: 3-69
Classification Level Classification E-value
Superfamily Interleukin 8-like chemokines 0.000000000000836
Family Interleukin 8-like chemokines 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K5KM20
Sequence length 80
Comment (tr|A0A2K5KM20|A0A2K5KM20_CERAT) C-C motif chemokine ligand 28 {ECO:0000313|Ensembl:ENSCATP00000001743} KW=Complete proteome; Reference proteome OX=9531 OS=Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys). GN=CCL28 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Cercocebus.
Sequence
MCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHSK
RNSNRAHQGKHETYGHKTPY
Download sequence
Identical sequences A0A2K5JLY0 A0A2K5KM20 A0A2K5XPW8
XP_011809876.1.43180 XP_011831836.1.47321 XP_011910708.1.92194 XP_011910709.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]