SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5MW78 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5MW78
Domain Number 1 Region: 37-84
Classification Level Classification E-value
Superfamily Cysteine-rich DNA binding domain, (DM domain) 3.27e-17
Family Cysteine-rich DNA binding domain, (DM domain) 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K5MW78
Sequence length 280
Comment (tr|A0A2K5MW78|A0A2K5MW78_CERAT) DMRT like family C2 {ECO:0000313|Ensembl:ENSCATP00000029446} KW=Complete proteome; Reference proteome OX=9531 OS=Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys). GN=DMRTC2 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Cercocebus.
Sequence
MEPSDMPAGYHCPSDSAPQNETRDPQGTELIPRRAISRSPTCARCRNHGVTAHLKGHKRL
CLFQACECHKCVLILERRRVMAAQVALRRQQEAQLKKHLMRRGEASPKAPNHFRKGTARP
QVPSGKENIAPQPQTPHGAVLLAPTPPGKNSCGPLLLSRPPEALPLSWTPVPPGPWVPGH
WLPPGLSMPPPVVCRLLYQEPALSLPPFPGFDPGTSLQLPTHGPFTTCPGSHPVLTAPLS
GEPQGPPSQPRTPLEPLAWPGHLPPQSGSCSKRQLKPSWG
Download sequence
Identical sequences A0A2K5MW78 A0A2K5XQH4 F6YWL8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]