SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5NS64 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5NS64
Domain Number 1 Region: 307-368
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000273
Family LIM domain 0.00072
Further Details:      
 
Domain Number 2 Region: 365-435
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000383
Family LIM domain 0.0014
Further Details:      
 
Domain Number 3 Region: 279-305
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000004
Family LIM domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2K5NS64
Sequence length 476
Comment (tr|A0A2K5NS64|A0A2K5NS64_CERAT) Thyroid hormone receptor interactor 6 {ECO:0000313|Ensembl:ENSCATP00000040225} KW=Complete proteome; Reference proteome OX=9531 OS=Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys). GN=TRIP6 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Cercocebus.
Sequence
MSGPTWLPPKQPEPARAPQGRAIPRGTPGPPPAHGAALQPHPRVNFCPLPSEQCYQAPGG
PEDRGPAWVGSHGVLQRTQGLPADRGGLRPGSLDAEIDLLSSTLAELNGGRGHVPRRPER
QAYEPLPPPAYRTGSLKPNPASPLPASPYGGPTPASYATASTPAGPAFPVQVKVAQPVRG
CGPPRRGASQASGPLPGPHFPLPGRGEVWGPGYRSQREPGPGAKEEAAGVSGPAGGGRGG
EHGPQVHLSQPPEDELDRLTKKLVHDMNHPPSGEYFGQCGGCGEDVVGDGAGVVALDRVF
HVGCFVCSTCRAQLRGQHFYAVERRAYCEGCYVATLEKCATCSQPILDRILRAMGKAYHP
GCFTCVVCHRGLDGIPFTVDATSQIHCIEDFHRKFAPRCSVCGGAIMPEPGQEETVRIVA
LDRSFHIGCYKCEECGLLLSSEGECQGCYPLDGHILCKACSAWRIQELSATVTTDC
Download sequence
Identical sequences A0A2K5NS64 A0A2K5V9D4 A0A2K6A818 F7HPJ8
ENSMMUP00000035425 ENSMMUP00000027988 XP_005549316.1.63531 XP_011841052.1.47321 XP_011912672.1.92194 XP_014989981.1.72884 9544.ENSMMUP00000027988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]