SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5NTH5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5NTH5
Domain Number 1 Region: 8-47
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000243
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K5NTH5
Sequence length 435
Comment (tr|A0A2K5NTH5|A0A2K5NTH5_CERAT) Chromosome 8 open reading frame 34 {ECO:0000313|Ensembl:ENSCATP00000040705} KW=Complete proteome; Reference proteome OX=9531 OS=Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys). GN=C8orf34 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Cercocebus.
Sequence
MASHPQTRIQAYLEKNKIGPLFEELMTKLITETPDQPIPFLIDHLQSKQGNRGQLQRTLS
GSAALWAESETSESKGTRRDFRSYDKPWQLNAKKPKKSKSDLAVSNISPPPTDSKSLPRS
VEHPKWNWRTKPQSRDFDELNHILQESKKLGKALENLSRSIAISDELDKETVAFNSSILR
PRVIGEWIGREENDADPLAAEMLQPPIPRSKNDQWESEDSGSSPAGSLKMEPKNKGLKQQ
QQQHKKLLAAMLSQDSFESIHSPTPSVTEEDIDNEDDAMELLEDLNDLRMEGVTTLVPSG
SKFNQGRPTYPAEPQAKVTLNICSRCARLQGDNLEERTEESLPMLHSPDEKIPDSFDSLP
GTEEALMEEGDEFEKASKLTGPDESLKQLQVVHQPWILPSDTESEGVEAEQEKRSADLLL
CVPCSSCPTLVYSGL
Download sequence
Identical sequences A0A2K5NTH5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]