SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5R1U5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5R1U5
Domain Number 1 Region: 54-236
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.63e-43
Family Ankyrin repeat 0.00042
Further Details:      
 
Domain Number 2 Region: 247-302,387-424
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000693
Family Pseudo ankyrin repeat 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2K5R1U5
Sequence length 477
Comment (tr|A0A2K5R1U5|A0A2K5R1U5_CEBCA) Ankyrin repeat, SAM and basic leucine zipper domain containing 1 {ECO:0000313|Ensembl:ENSCCAP00000022080} KW=Complete proteome OX=1737458 OS=Cebus capucinus imitator. GN=ASZ1 OC=Platyrrhini; Cebidae; Cebinae; Cebus.
Sequence
MAASALRGLAVAGGGESSESEDDGWEIGYLDRTSQKLKGQMLPIEEKKEKFKKALTTGDV
SLVQELLDSGIISVDATFRYGWTPLMYAASVANAELVRVLLDRGANASFEKDKQTILITA
CSAHGSEEQILKCVELLLSRNADPNVACRRLMTPIMYAARDGHTQVVALLVASGAEVNTQ
DENGYTALTWAARQGHKSIVLKLLELGANKMLQTKDGKLPSEIAKRNKHHEIFNLLSFTL
NPLEGKLQQLTKEETICKILTTDSDRENDHIFSSYAAFGDLEVFLHGLGLEHMTDLLKER
DITLRQLLTMREDEFTKNGFTRKDQQKILAALKELEVEEIQFGELSEEAKLEISGDEFLN
FLLKLNKQCGHLITAVQNIITELPVNSQKIALEWASPQNFTSVCEELVKNVEDLSEEVCN
LKDLIQKLQNERENDPTHIPLREEVSTWNSRILKRTAITVCGFGFLLFICKITFQRK
Download sequence
Identical sequences A0A2K5R1U5
XP_017390565.1.71028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]