SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2K5V627 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2K5V627
Domain Number 1 Region: 113-234
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.93e-32
Family cAMP-binding domain 0.000000523
Further Details:      
 
Domain Number 2 Region: 242-366
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.01e-31
Family cAMP-binding domain 0.000000767
Further Details:      
 
Domain Number 3 Region: 15-62
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 8.63e-18
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000966
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2K5V627
Sequence length 375
Comment (tr|A0A2K5V627|A0A2K5V627_MACFA) Uncharacterized protein {ECO:0000313|Ensembl:ENSMFAP00000020180} OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN= OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MESGSTAASEEARSLQECELYVQKHNIQALLKDSIVQLCTARPERPMVFLREYFERLEKE
EAKQIQNLQKAGTRTDSREDEISPPPPNPVVKGRSAEVYTEEDATSYVRKVIPKDYKTMA
ALAKAIEKNVLFSHLDDNERSDIFDAMFSVSFIAGETVIQQGDEGDNFYVIDQGETDVYV
NNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDQDSYRRILMGSTLRKRKMY
EELLSKVSILESLDKWERLMAADALEPVQFEDGQKIVVQGEPGDEFFIILEGSVAVLQRH
SENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKLDRPRFECVLGPCSDIL
KRNIQQYNSFVSLSV
Download sequence
Identical sequences A0A2K5V627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]